Lineage for d3d5al1 (3d5a L:4-127)

  1. Root: SCOPe 2.07
  2. 2647132Class i: Low resolution protein structures [58117] (25 folds)
  3. 2647133Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 2647134Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 2647135Family i.1.1.1: Ribosome complexes [58120] (3 proteins)
  6. 2647136Protein 70S ribosome functional complex [58121] (4 species)
  7. 2647693Species Thermus thermophilus [TaxId:274] [58122] (20 PDB entries)
  8. 2647770Domain d3d5al1: 3d5a L:4-127 [157346]
    Other proteins in same PDB: d3d5ab1, d3d5ad1, d3d5ae1, d3d5af1, d3d5ag1, d3d5ah1, d3d5ai1, d3d5aj1, d3d5ak1, d3d5an1, d3d5aq1, d3d5ar1, d3d5at1, d3d5au1
    complexed with mg, zn
    complexed with mg, zn

Details for d3d5al1

PDB Entry: 3d5a (more details), 3.21 Å

PDB Description: Structural basis for translation termination on the 70S ribosome. This file contains the 30S subunit, release factor 1 (RF1), two tRNA, and mRNA molecules of one 70S ribosome. The entire crystal structure contains two 70S ribosomes as described in remark 400.
PDB Compounds: (L:) 30S ribosomal protein S12

SCOPe Domain Sequences for d3d5al1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d5al1 i.1.1.1 (L:4-127) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]}
ptinqlvrkgrekvrkkskvpalkgapfrrgvctvvrtvtpkkpnsalrkvakvrltsgy
evtayipgeghnlqehsvvlirggrvkdlpgvryhivrgvydaagvkdrkksrskygtkk
pkea

SCOPe Domain Coordinates for d3d5al1:

Click to download the PDB-style file with coordinates for d3d5al1.
(The format of our PDB-style files is described here.)

Timeline for d3d5al1: