Lineage for d3d5ag1 (3d5a G:2-156)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2331851Fold a.75: Ribosomal protein S7 [47972] (1 superfamily)
    core: 5 helices; contains one more helix and a beta-hairpin outside the core
  4. 2331852Superfamily a.75.1: Ribosomal protein S7 [47973] (1 family) (S)
  5. 2331853Family a.75.1.1: Ribosomal protein S7 [47974] (1 protein)
  6. 2331854Protein Ribosomal protein S7 [47975] (4 species)
  7. 2331884Species Thermus thermophilus [TaxId:274] [47977] (47 PDB entries)
    Uniprot P17291
  8. 2331912Domain d3d5ag1: 3d5a G:2-156 [157341]
    Other proteins in same PDB: d3d5ab1, d3d5ad1, d3d5ae1, d3d5af1, d3d5ah1, d3d5ai1, d3d5aj1, d3d5ak1, d3d5al1, d3d5an1, d3d5ao1, d3d5ap1, d3d5aq1, d3d5ar1, d3d5as1, d3d5at1, d3d5au1
    complexed with mg, zn
    complexed with mg, zn

Details for d3d5ag1

PDB Entry: 3d5a (more details), 3.21 Å

PDB Description: Structural basis for translation termination on the 70S ribosome. This file contains the 30S subunit, release factor 1 (RF1), two tRNA, and mRNA molecules of one 70S ribosome. The entire crystal structure contains two 70S ribosomes as described in remark 400.
PDB Compounds: (G:) 30S ribosomal protein S7

SCOPe Domain Sequences for d3d5ag1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d5ag1 a.75.1.1 (G:2-156) Ribosomal protein S7 {Thermus thermophilus [TaxId: 274]}
arrrraevrqlqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkv
fkqavenvkprmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavria
helmdaaegkggavkkkedvermaeanrayahyrw

SCOPe Domain Coordinates for d3d5ag1:

Click to download the PDB-style file with coordinates for d3d5ag1.
(The format of our PDB-style files is described here.)

Timeline for d3d5ag1: