SCOPe 2.05: Domain d3d5ad1: 3d5a D:2-209

Lineage for d3d5ad1 (3d5a D:2-209)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily)
   alpha(2)-beta(2)-loop-beta; 2 layers: alpha/beta

4. Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (5 families)
   common motif in otherwise different folds

5. Family d.66.1.2: Ribosomal protein S4 (bacteria) [55178] (1 protein)
   has a RRF/tRNA synthetase additional domain-like fold

6. Protein Ribosomal protein S4 [55179] (3 species)
   also contains a Zn-binding N-terminal subdomain

7. Species Thermus thermophilus [TaxId:274] [55180] (45 PDB entries)

8. Domain d3d5ad1: 3d5a D:2-209 [157338]
   Other proteins in same PDB: d3d5ab1, d3d5ae1, d3d5af1, d3d5ag1, d3d5ah1, d3d5ai1, d3d5aj1, d3d5ak1, d3d5al1, d3d5an1, d3d5ao1, d3d5ap1, d3d5aq1, d3d5ar1, d3d5as1, d3d5at1, d3d5au1
   complexed with mg, zn
   complexed with mg, zn

Details for d3d5ad1

PDB Entry: 3d5a, 3.21 Å

PDB Description: Structural basis for translation termination on the 70S ribosome. This file contains the 30S subunit, release factor 1 (RF1), two tRNA, and mRNA molecules of one 70S ribosome. The entire crystal structure contains two 70S ribosomes as described in remark 400.

PDB Compounds: (D:) 30S ribosomal protein S4

SCOPe Domain Sequences for d3d5ad1:

Sequence; same for both SEQRES and ATOM records:

>d3d5ad1 d.66.1.2 (D:2-209) Ribosomal protein S4 {Thermus thermophilus [TaxId: 274]}
gryigpvcrlcrregvklylkgercyspkcamerrpyppgqhgqkrarrpsdyavrlrek
qklrriygiserqfrnlfeeaskkkgvtgsvflgllesrldnvvyrlgfavsrrqarqlv
rhghitvngrrvdlpsyrvrpgdeiavaeksrnlelirqnleamkgrkvgpwlsldvegm
kgkflrlpdredlalpvneqlviefysr

Timeline for d3d5ad1:

• d3d5ad1 first appeared in SCOP 1.75
  
• d3d5ad1 appears in SCOPe 2.04
  
• d3d5ad1 appears in SCOPe 2.06
  
• d3d5ad1 appears in the current release, SCOPe 2.08