![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.15: Ribosomal protein S2 [52313] (1 family) ![]() fold elaborated with additional structures |
![]() | Family c.23.15.1: Ribosomal protein S2 [52314] (1 protein) |
![]() | Protein Ribosomal protein S2 [52315] (3 species) |
![]() | Species Thermus thermophilus [TaxId:274] [52316] (46 PDB entries) Uniprot P80371 |
![]() | Domain d3d5ab1: 3d5a B:7-240 [157337] Other proteins in same PDB: d3d5ad1, d3d5ae1, d3d5af1, d3d5ag1, d3d5ah1, d3d5ai1, d3d5aj1, d3d5ak1, d3d5al1, d3d5an1, d3d5ao1, d3d5ap1, d3d5aq1, d3d5ar1, d3d5as1, d3d5at1, d3d5au1 automatically matched to d1i94b_ complexed with mg, zn |
PDB Entry: 3d5a (more details), 3.21 Å
SCOP Domain Sequences for d3d5ab1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3d5ab1 c.23.15.1 (B:7-240) Ribosomal protein S2 {Thermus thermophilus [TaxId: 274]} vkelleagvhfgherkrwnpkfaryiyaerngihiidlqktmeelertfrfiedlamrgg tilfvgtkkqaqdivrmeaeragmpyvnqrwlggmltnfktisqrvhrleelealfaspe ieerpkkeqvrlkhelerlqkylsgfrllkrlpdaifvvdptkeaiavrearklfipvia ladtdsdpdlvdyiipgnddairsiqlilsravdliiqarggvvepspsyalvq
Timeline for d3d5ab1: