SCOPe 2.06: Domain d3d4ub2: 3d4u B:38-74

Lineage for d3d4ub2 (3d4u B:38-74)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.9: Defensin-like [57391] (1 superfamily)
   Disulfide-rich fold, nearly all-beta

4. Superfamily g.9.1: Defensin-like [57392] (3 families)

5. Family g.9.1.3: Tick carboxypeptidase inhibitor-like [161135] (2 proteins)

6. Protein Carboxypeptidase inhibitor [161136] (1 species)
   consists of two structurally similar to beta-defensin domains

7. Species Tick (Rhipicephalus bursa) [TaxId:67831] [161137] (4 PDB entries)
   Uniprot Q5EPH2 23-59! Uniprot Q5EPH2 60-96

8. Domain d3d4ub2: 3d4u B:38-74 [157301]
   Other proteins in same PDB: d3d4ua_
   complexed with act, so4, zn

Details for d3d4ub2

PDB Entry: 3d4u, 1.7 Å

PDB Description: Bovine thrombin-activatable fibrinolysis inhibitor (TAFIa) in complex with tick-derived carboxypeptidase inhibitor.

PDB Compounds: (B:) carboxypeptidase inhibitor

SCOPe Domain Sequences for d3d4ub2:

Sequence; same for both SEQRES and ATOM records:

>d3d4ub2 g.9.1.3 (B:38-74) Carboxypeptidase inhibitor {Tick (Rhipicephalus bursa) [TaxId: 67831]}
tgckgkggecnpldrqckelqaesascgkgqkccvwl

Timeline for d3d4ub2:

• d3d4ub2 first appeared in SCOP 1.75
  
• d3d4ub2 appears in SCOPe 2.05
  
• d3d4ub2 appears in SCOPe 2.07
  
• d3d4ub2 appears in the current release, SCOPe 2.08