SCOP 1.75: Domain d3d4ub1: 3d4u B:1-37

Lineage for d3d4ub1 (3d4u B:1-37)

1. Root: SCOP 1.75

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.9: Defensin-like [57391] (1 superfamily)
   Disulfide-rich fold, nearly all-beta

4. Superfamily g.9.1: Defensin-like [57392] (3 families)

5. Family g.9.1.3: Tick carboxypeptidase inhibitor-like [161135] (1 protein)

6. Protein Carboxypeptidase inhibitor [161136] (1 species)
   consists of two structurally similar to beta-defensin domains

7. Species Tick (Rhipicephalus bursa) [TaxId:67831] [161137] (4 PDB entries)
   Uniprot Q5EPH2 23-59! Uniprot Q5EPH2 60-96

8. Domain d3d4ub1: 3d4u B:1-37 [157300]
   automatically matched to 1ZLH B:1-37
   complexed with act, so4, zn

Details for d3d4ub1

PDB Entry: 3d4u, 1.7 Å

PDB Description: Bovine thrombin-activatable fibrinolysis inhibitor (TAFIa) in complex with tick-derived carboxypeptidase inhibitor.

PDB Compounds: (B:) carboxypeptidase inhibitor

SCOP Domain Sequences for d3d4ub1:

Sequence; same for both SEQRES and ATOM records:

>d3d4ub1 g.9.1.3 (B:1-37) Carboxypeptidase inhibitor {Tick (Rhipicephalus bursa) [TaxId: 67831]}
necvskgfgclpqsdcpqearlsyggcstvccdlskl

Timeline for d3d4ub1:

• d3d4ub1 is new in SCOP 1.75
  
• d3d4ub1 appears in SCOPe 2.01
  
• d3d4ub1 appears in the current release, SCOPe 2.08