Lineage for d3d3xa_ (3d3x A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2204982Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2204983Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2205348Family d.92.1.7: Clostridium neurotoxins, catalytic domain [55512] (2 proteins)
  6. 2205349Protein Botulinum neurotoxin [55513] (4 species)
  7. 2205409Species Clostridium butyricum [TaxId:1492] [160551] (1 PDB entry)
  8. 2205410Domain d3d3xa_: 3d3x A: [157287]
    automated match to d1t3aa_
    complexed with so4, zn

Details for d3d3xa_

PDB Entry: 3d3x (more details), 2.25 Å

PDB Description: Crystal structure of botulinum neurotoxin serotype E catalytic domain in complex with SNAP-25 substrate peptide
PDB Compounds: (A:) Type E botulinum toxin

SCOPe Domain Sequences for d3d3xa_:

Sequence, based on SEQRES records: (download)

>d3d3xa_ d.92.1.7 (A:) Botulinum neurotoxin {Clostridium butyricum [TaxId: 1492]}
pkinsfnyndpvndrtilyikpggcqefyksfnimkniwiipernvigttpqdfhpptsl
kngdssyydpnylqsdeekdrflkivtkifnrinnnlsggilleelskanpylgndntpd
nqfhigdasaveikfsngsqdillpnviimgaepdlfetnssnislrnnympsnhgfgsi
aivtfspeysfrfndnsmnefiqdpaltlmhelihslhglygakgittkytitqkqnpli
tnirgtnieefltfggtdlniitsaqsndiytnlladykkiasklskvqvsnpllnpykd
vfeakygldkdasgiysvninkfndifkklysftefdlatkfqvkcrqtyigqykyfkls
nllndsiynisegyninnlkvnfrgqnanlnpriitpitgrglvkkiirfc

Sequence, based on observed residues (ATOM records): (download)

>d3d3xa_ d.92.1.7 (A:) Botulinum neurotoxin {Clostridium butyricum [TaxId: 1492]}
pkinsfnyndpvndrtilyikpggcqefyksfnimkniwiipernvigttpqdfhpptsl
kngdssyydpnylqsdeekdrflkivtkifnrinnnlsggilleelskanpylgndntpd
nqfhigdasaveikfsngsqdillpnviimgaepdlfetnssnislrnnympsnhgfgsi
aivtfspeysfrfndnsmnefiqdpaltlmhelihslhglygakgittkytitqlitnir
gtnieefltfggtdlniitsaqsndiytnlladykkiasklskvqvsnpllnpykdvfea
kygldkdasgiysvninkfndifkklysftefdlatkfqvkcrqtyigqykyfklsnlln
dsiynisegyninnlkvnfrgqnanlnpriitpitgrglvkkiirfc

SCOPe Domain Coordinates for d3d3xa_:

Click to download the PDB-style file with coordinates for d3d3xa_.
(The format of our PDB-style files is described here.)

Timeline for d3d3xa_: