Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
Superfamily d.2.1: Lysozyme-like [53955] (12 families) |
Family d.2.1.10: PBP transglycosylase domain-like [159832] (3 proteins) Pfam PF00912; lacking the characteristic beta-sheet; otherwise has a similar fold to the Family 19 glycosidase |
Protein Penicillin-binding protein 1a, PBP1a [159833] (1 species) |
Species Aquifex aeolicus [TaxId:63363] [159834] (2 PDB entries) Uniprot O66874 57-243 |
Domain d3d3ha_: 3d3h A: [157284] automated match to d2oqoa1 complexed with m4o |
PDB Entry: 3d3h (more details), 2.31 Å
SCOPe Domain Sequences for d3d3ha_:
Sequence, based on SEQRES records: (download)
>d3d3ha_ d.2.1.10 (A:) Penicillin-binding protein 1a, PBP1a {Aquifex aeolicus [TaxId: 63363]} qkrfyvsidkipehvinafvatedrnfwhhfgidpvaivraaivnyragrivqggstitq qlaknlfltrertlerkikeallaikiertfdkkkimelylnqiylgsgaygveaaaqvy fgkhvwelsldeaallaalpkapakynpfyhperalqrrnlvlkrmleegyitpeqyeea vnk
>d3d3ha_ d.2.1.10 (A:) Penicillin-binding protein 1a, PBP1a {Aquifex aeolicus [TaxId: 63363]} qkrfyvsidkipehvinafvatedrnfwhhfgidpvaivraaiqggstitqqlaknlflt rertlerkikeallaikiertfdkkkimelylnqiylgsgaygveaaaqvyfgkhvwels ldeaallaalpkapakynpfyhperalqrrnlvlkrmleegyitpeqyeeavnk
Timeline for d3d3ha_: