Lineage for d3d38m1 (3d38 M:1-323)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2579766Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 2579767Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 2579768Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 2579858Protein M (medium) subunit [81481] (4 species)
  7. 2579931Species Rhodopseudomonas viridis [TaxId:1079] [81478] (14 PDB entries)
  8. 2579944Domain d3d38m1: 3d38 M:1-323 [157277]
    Other proteins in same PDB: d3d38c1, d3d38h1, d3d38h2, d3d38l1
    automatically matched to d1dxrm_
    complexed with bcb, bpb, fe2, hec, hto, lda, mq9, ns5, so4, uq1

Details for d3d38m1

PDB Entry: 3d38 (more details), 3.21 Å

PDB Description: Crystal structure of new trigonal form of photosynthetic reaction center from Blastochloris viridis. Crystals grown in microfluidics by detergent capture.
PDB Compounds: (M:) reaction center protein m chain

SCOPe Domain Sequences for d3d38m1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d38m1 f.26.1.1 (M:1-323) M (medium) subunit {Rhodopseudomonas viridis [TaxId: 1079]}
adyqtiytqiqargphitvsgewgdndrvgkpfysywlgkigdaqigpiylgasgiaafa
fgstailiilfnmaaevhfdplqffrqffwlglyppkaqygmgipplhdggwwlmaglfm
tlslgswwirvysraralglgthiawnfaaaiffvlcigcihptlvgswsegvpfgiwph
idwltafsirygnfyycpwhgfsigfaygcgllfaahgatilavarfggdreieqitdrg
taveraalfwrwtigfnatiesvhrwgwffslmvmvsasvgilltgtfvdnwylwcvkhg
aapdypaylpatpdpaslpgapk

SCOPe Domain Coordinates for d3d38m1:

Click to download the PDB-style file with coordinates for d3d38m1.
(The format of our PDB-style files is described here.)

Timeline for d3d38m1: