Lineage for d3d38h2 (3d38 H:1-36)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2577985Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2578573Superfamily f.23.10: Photosystem II reaction centre subunit H, transmembrane region [81490] (2 families) (S)
  5. 2578574Family f.23.10.1: Photosystem II reaction centre subunit H, transmembrane region [81489] (1 protein)
  6. 2578575Protein Photosystem II reaction centre subunit H, transmembrane region [81488] (4 species)
  7. 2578671Species Rhodopseudomonas viridis [TaxId:1079] [81485] (19 PDB entries)
    synonym: blastochloris viridis
  8. 2578689Domain d3d38h2: 3d38 H:1-36 [157275]
    Other proteins in same PDB: d3d38c1, d3d38h1, d3d38l1, d3d38m1
    automatically matched to d1dxrh2
    complexed with bcb, bpb, fe2, hec, hto, lda, mq9, ns5, so4, uq1

Details for d3d38h2

PDB Entry: 3d38 (more details), 3.21 Å

PDB Description: Crystal structure of new trigonal form of photosynthetic reaction center from Blastochloris viridis. Crystals grown in microfluidics by detergent capture.
PDB Compounds: (H:) reaction center protein h chain

SCOPe Domain Sequences for d3d38h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d38h2 f.23.10.1 (H:1-36) Photosystem II reaction centre subunit H, transmembrane region {Rhodopseudomonas viridis [TaxId: 1079]}
myhgalaqhldiaqlvwyaqwlviwtvvllylrred

SCOPe Domain Coordinates for d3d38h2:

Click to download the PDB-style file with coordinates for d3d38h2.
(The format of our PDB-style files is described here.)

Timeline for d3d38h2: