Lineage for d3d38h1 (3d38 H:37-258)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2061299Fold b.41: PRC-barrel domain [50345] (1 superfamily)
    core: barrel, partly opened; n*=5, S*=8; meander
  4. 2061300Superfamily b.41.1: PRC-barrel domain [50346] (5 families) (S)
  5. 2061301Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins)
  6. 2061302Protein Photosynthetic reaction centre [50348] (4 species)
  7. 2061398Species Rhodopseudomonas viridis [TaxId:1079] [50349] (19 PDB entries)
  8. 2061416Domain d3d38h1: 3d38 H:37-258 [157274]
    Other proteins in same PDB: d3d38c1, d3d38h2, d3d38l1, d3d38m1
    automatically matched to d1dxrh1
    complexed with bcb, bpb, fe2, hec, hto, lda, mq9, ns5, so4, uq1

Details for d3d38h1

PDB Entry: 3d38 (more details), 3.21 Å

PDB Description: Crystal structure of new trigonal form of photosynthetic reaction center from Blastochloris viridis. Crystals grown in microfluidics by detergent capture.
PDB Compounds: (H:) reaction center protein h chain

SCOPe Domain Sequences for d3d38h1:

Sequence, based on SEQRES records: (download)

>d3d38h1 b.41.1.1 (H:37-258) Photosynthetic reaction centre {Rhodopseudomonas viridis [TaxId: 1079]}
rregyplveplglvklapedgqvyelpypktfvlphggtvtvprrrpetrelklaqtdgf
egaplqptgnplvdavgpasyaeraevvdatvdgkakivplrvatdfsiaegdvdprglp
vvaadgveagtvtdlwvdrsehyfrylelsvagsartaliplgfcdvkkdkivvtsilse
qfanvprlqsrdqitlreedkvsayyaggllyatperaesll

Sequence, based on observed residues (ATOM records): (download)

>d3d38h1 b.41.1.1 (H:37-258) Photosynthetic reaction centre {Rhodopseudomonas viridis [TaxId: 1079]}
rregyplvepedgqvyelpypktfvlphggtvtvprrrpetrelklaqtdgfegaplqpt
gnplvdavgpasyaeraevvdatvdgkakivplrvatdfsiaegdvdprglpvvaadgve
agtvtdlwvdrsehyfrylelsvagsartaliplgfcdvkkdkivvtsilseqfanvprl
qsrdqitlreedkvsayyaggllyatperaesll

SCOPe Domain Coordinates for d3d38h1:

Click to download the PDB-style file with coordinates for d3d38h1.
(The format of our PDB-style files is described here.)

Timeline for d3d38h1: