SCOPe 2.02: Domain d3d29z_: 3d29 Z:

Lineage for d3d29z_ (3d29 Z:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein Proteasome beta subunit (catalytic) [56252] (5 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (34 PDB entries)
   The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)

8. Domain d3d29z_: 3d29 Z: [157244]
   Other proteins in same PDB: d3d29a_, d3d29b_, d3d29c_, d3d29e_, d3d29f_, d3d29g_, d3d29o_, d3d29p_, d3d29q_, d3d29s_, d3d29t_, d3d29u_
   automated match to d1g0ul_
   complexed with feb

Details for d3d29z_

PDB Entry: 3d29, 2.6 Å

PDB Description: proteasome inhibition by fellutamide b

PDB Compounds: (Z:) Proteasome component C5 precursor

SCOPe Domain Sequences for d3d29z_:

Sequence; same for both SEQRES and ATOM records:

>d3d29z_ d.153.1.4 (Z:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qfnpygdnggtilgiagedfavlagdtrnitdysinsryepkvfdcgdnivmsangfaad
gdalvkrfknsvkwyhfdhndkklsinsaarniqhllygkrffpyyvhtiiagldedgkg
avysfdpvgsyereqcraggaaaslimpfldnqvnfknqyepgtngkvkkplkylsveev
iklvrdsftsaterhiqvgdgleilivtkdgvrkefyelkrd

Timeline for d3d29z_:

• d3d29z_ first appeared in SCOP 1.75, called d3d29z1
  
• d3d29z_ appears in SCOPe 2.01
  
• d3d29z_ appears in SCOPe 2.03
  
• d3d29z_ appears in the current release, SCOPe 2.08