Lineage for d3d29q_ (3d29 Q:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1934404Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1934405Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1934574Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1934686Protein Proteasome alpha subunit (non-catalytic) [56255] (7 species)
    contains an extension to the common fold at the N-terminus
  7. 1934702Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (76 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 1934890Domain d3d29q_: 3d29 Q: [157236]
    Other proteins in same PDB: d3d291_, d3d292_, d3d29d_, d3d29g_, d3d29h_, d3d29i_, d3d29j_, d3d29k_, d3d29l_, d3d29m_, d3d29n_, d3d29r_, d3d29u_, d3d29v_, d3d29w_, d3d29x_, d3d29y_, d3d29z_
    automated match to d1g65c_
    complexed with feb

Details for d3d29q_

PDB Entry: 3d29 (more details), 2.6 Å

PDB Description: proteasome inhibition by fellutamide b
PDB Compounds: (Q:) Proteasome component PRE6

SCOPe Domain Sequences for d3d29q_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d29q_ d.153.1.4 (Q:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe
q

SCOPe Domain Coordinates for d3d29q_:

Click to download the PDB-style file with coordinates for d3d29q_.
(The format of our PDB-style files is described here.)

Timeline for d3d29q_: