Lineage for d3d29i1 (3d29 I:-8-194)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 875596Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 875597Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (7 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 875747Family d.153.1.4: Proteasome subunits [56251] (3 proteins)
  6. 876137Protein Proteasome beta subunit (catalytic) [56252] (5 species)
  7. 876210Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (12 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 876228Domain d3d29i1: 3d29 I:-8-194 [157228]
    Other proteins in same PDB: d3d29a1, d3d29b1, d3d29c1, d3d29e1, d3d29f1, d3d29g1, d3d29o1, d3d29p1, d3d29q1, d3d29s1, d3d29t1, d3d29u1
    automatically matched to d1g0ui_
    complexed with feb

Details for d3d29i1

PDB Entry: 3d29 (more details), 2.6 Å

PDB Description: proteasome inhibition by fellutamide b
PDB Compounds: (I:) Proteasome component PUP3

SCOP Domain Sequences for d3d29i1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d29i1 d.153.1.4 (I:-8-194) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sdpssinggivvamtgkdcvaiacdlrlgsqslgvsnkfekifhyghvflgitglatdvt
tlnemfryktnlyklkeeraiepetftqlvssslyerrfgpyfvgpvvaginsksgkpfi
agfdligcideakdfivsgtasdqlfgmceslyepnlepedlfetisqallnaadrdals
gwgavvyiikkdevvkrylkmrqd

SCOP Domain Coordinates for d3d29i1:

Click to download the PDB-style file with coordinates for d3d29i1.
(The format of our PDB-style files is described here.)

Timeline for d3d29i1: