Lineage for d3d29g2 (3d29 G:8-240)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2224775Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2228394Protein automated matches [190144] (11 species)
    not a true protein
  7. 2228415Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (41 PDB entries)
  8. 2228514Domain d3d29g2: 3d29 G:8-240 [157226]
    Other proteins in same PDB: d3d291_, d3d292_, d3d29a_, d3d29b_, d3d29c2, d3d29c3, d3d29d_, d3d29e_, d3d29f_, d3d29g3, d3d29h_, d3d29i_, d3d29j_, d3d29k_, d3d29l_, d3d29m_, d3d29n_, d3d29o_, d3d29p_, d3d29q2, d3d29q3, d3d29r_, d3d29s_, d3d29t_, d3d29u3, d3d29v_, d3d29w_, d3d29x_, d3d29y_, d3d29z_
    automated match to d1g65g_
    complexed with feb

Details for d3d29g2

PDB Entry: 3d29 (more details), 2.6 Å

PDB Description: proteasome inhibition by fellutamide b
PDB Compounds: (G:) Proteasome component C7-alpha

SCOPe Domain Sequences for d3d29g2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d29g2 d.153.1.4 (G:8-240) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttvsy
ifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiytqr
aymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkkski
dhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaiaeq
d

SCOPe Domain Coordinates for d3d29g2:

Click to download the PDB-style file with coordinates for d3d29g2.
(The format of our PDB-style files is described here.)

Timeline for d3d29g2: