Lineage for d3d1kb_ (3d1k B:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1253685Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1253686Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1253759Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1254600Protein Hemoglobin, beta-chain [46500] (24 species)
  7. 1254605Species Antarctic fish (Trematomus newnesi) [TaxId:35730] [46513] (6 PDB entries)
  8. 1254606Domain d3d1kb_: 3d1k B: [157209]
    Other proteins in same PDB: d3d1ka_
    automated match to d1t1nb_
    complexed with ace, cmo, hem

Details for d3d1kb_

PDB Entry: 3d1k (more details), 1.25 Å

PDB Description: R/T intermediate quaternary structure of an antarctic fish hemoglobin in an alpha(CO)-beta(pentacoordinate) state
PDB Compounds: (B:) Hemoglobin subunit beta-1/2

SCOPe Domain Sequences for d3d1kb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d1kb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Antarctic fish (Trematomus newnesi) [TaxId: 35730]}
vewtdkersiisdifshmdyddigpkalsrclvvypwtqryfsgfgnlynaegimsnanv
aahgikvlhgldrgmknmdniadaytdlstlhseklhvdpdnfkllsdcitivlaakmgh
aftaetqgafqkflaavvsalgkqyh

SCOPe Domain Coordinates for d3d1kb_:

Click to download the PDB-style file with coordinates for d3d1kb_.
(The format of our PDB-style files is described here.)

Timeline for d3d1kb_: