SCOP 1.75: Domain d3d1kb1: 3d1k B:1-146

Lineage for d3d1kb1 (3d1k B:1-146)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (24 species)

7. Species Antarctic fish (Trematomus newnesi) [TaxId:35730] [46513] (4 PDB entries)

8. Domain d3d1kb1: 3d1k B:1-146 [157209]
   Other proteins in same PDB: d3d1ka1
   automatically matched to d1t1nb_
   complexed with ace, cmo, hem

Details for d3d1kb1

PDB Entry: 3d1k, 1.25 Å

PDB Description: R/T intermediate quaternary structure of an antarctic fish hemoglobin in an alpha(CO)-beta(pentacoordinate) state

PDB Compounds: (B:) Hemoglobin subunit beta-1/2

SCOP Domain Sequences for d3d1kb1:

Sequence; same for both SEQRES and ATOM records:

>d3d1kb1 a.1.1.2 (B:1-146) Hemoglobin, beta-chain {Antarctic fish (Trematomus newnesi) [TaxId: 35730]}
vewtdkersiisdifshmdyddigpkalsrclvvypwtqryfsgfgnlynaegimsnanv
aahgikvlhgldrgmknmdniadaytdlstlhseklhvdpdnfkllsdcitivlaakmgh
aftaetqgafqkflaavvsalgkqyh

Timeline for d3d1kb1:

• d3d1kb1 is new in SCOP 1.75
  
• d3d1kb1 is called d3d1kb_ in SCOPe 2.01
  
• d3d1kb1 appears in the current release, SCOPe 2.08, called d3d1kb_