Lineage for d3d1ka_ (3d1k A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1715732Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1715733Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1715807Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1716076Protein Hemoglobin, alpha-chain [46486] (23 species)
  7. 1716081Species Antarctic fish (Trematomus newnesi) [TaxId:35730] [46497] (6 PDB entries)
  8. 1716082Domain d3d1ka_: 3d1k A: [157208]
    Other proteins in same PDB: d3d1kb_
    automated match to d1la6a_
    complexed with ace, cmo, hem

Details for d3d1ka_

PDB Entry: 3d1k (more details), 1.25 Å

PDB Description: R/T intermediate quaternary structure of an antarctic fish hemoglobin in an alpha(CO)-beta(pentacoordinate) state
PDB Compounds: (A:) Hemoglobin subunit alpha-1

SCOPe Domain Sequences for d3d1ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d1ka_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Antarctic fish (Trematomus newnesi) [TaxId: 35730]}
slsdkdkaavralwskigkssdaigndalsrmivvypqtkiyfshwpdvtpgspnikahg
kkvmggialavskiddlktglmelseqhayklrvdpsnfkilnhcilvvistmfpkeftp
eahvsldkflsgvalalaeryr

SCOPe Domain Coordinates for d3d1ka_:

Click to download the PDB-style file with coordinates for d3d1ka_.
(The format of our PDB-style files is described here.)

Timeline for d3d1ka_: