Class a: All alpha proteins [46456] (286 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein Hemoglobin, alpha-chain [46486] (23 species) |
Species Antarctic fish (Trematomus newnesi) [TaxId:35730] [46497] (6 PDB entries) |
Domain d3d1ka_: 3d1k A: [157208] Other proteins in same PDB: d3d1kb_ automated match to d1la6a_ complexed with ace, cmo, hem |
PDB Entry: 3d1k (more details), 1.25 Å
SCOPe Domain Sequences for d3d1ka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3d1ka_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Antarctic fish (Trematomus newnesi) [TaxId: 35730]} slsdkdkaavralwskigkssdaigndalsrmivvypqtkiyfshwpdvtpgspnikahg kkvmggialavskiddlktglmelseqhayklrvdpsnfkilnhcilvvistmfpkeftp eahvsldkflsgvalalaeryr
Timeline for d3d1ka_: