Class a: All alpha proteins [46456] (284 folds) |
Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.10: Epsilon subunit of F1F0-ATP synthase C-terminal domain [46604] (1 family) |
Family a.2.10.1: Epsilon subunit of F1F0-ATP synthase C-terminal domain [46605] (1 protein) |
Protein Epsilon subunit of F1F0-ATP synthase C-terminal domain [46606] (2 species) delta subunit in mitochondria this domain unfolds when bound to the gamma subunit |
Species Escherichia coli [TaxId:562] [46607] (4 PDB entries) |
Domain d1bsha1: 1bsh A:87-138 [15720] Other proteins in same PDB: d1bsha2 |
PDB Entry: 1bsh (more details)
SCOP Domain Sequences for d1bsha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bsha1 a.2.10.1 (A:87-138) Epsilon subunit of F1F0-ATP synthase C-terminal domain {Escherichia coli [TaxId: 562]} qdldearameakrkaeehissshgdvdyaqasaelakaiaqlrvieltkkam
Timeline for d1bsha1: