Lineage for d1aqta1 (1aqt A:87-136)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1077399Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 1077619Superfamily a.2.10: Epsilon subunit of F1F0-ATP synthase C-terminal domain [46604] (1 family) (S)
  5. 1077620Family a.2.10.1: Epsilon subunit of F1F0-ATP synthase C-terminal domain [46605] (1 protein)
  6. 1077621Protein Epsilon subunit of F1F0-ATP synthase C-terminal domain [46606] (2 species)
    delta subunit in mitochondria
    this domain unfolds when bound to the gamma subunit
  7. 1077627Species Escherichia coli [TaxId:562] [46607] (4 PDB entries)
  8. 1077628Domain d1aqta1: 1aqt A:87-136 [15718]
    Other proteins in same PDB: d1aqta2

Details for d1aqta1

PDB Entry: 1aqt (more details), 2.3 Å

PDB Description: epsilon subunit of f1f0-atp synthase from escherichia coli
PDB Compounds: (A:) ATP synthase

SCOPe Domain Sequences for d1aqta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aqta1 a.2.10.1 (A:87-136) Epsilon subunit of F1F0-ATP synthase C-terminal domain {Escherichia coli [TaxId: 562]}
qdldearameakrkaeehissshgdvdyaqasaelakaiaqlrvieltkk

SCOPe Domain Coordinates for d1aqta1:

Click to download the PDB-style file with coordinates for d1aqta1.
(The format of our PDB-style files is described here.)

Timeline for d1aqta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1aqta2