SCOPe 2.02: Domain d3cxht_: 3cxh T:

Lineage for d3cxht_ (3cxh T:)

1. Root: SCOPe 2.02

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
   not a true fold

4. Superfamily f.23.14: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81514] (1 family)

5. Family f.23.14.1: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81513] (2 proteins)

6. Protein automated matches [190326] (3 species)
   not a true protein

7. Species Saccharomyces cerevisiae [TaxId:559292] [187308] (2 PDB entries)

8. Domain d3cxht_: 3cxh T: [157138]
   Other proteins in same PDB: d3cxha1, d3cxha2, d3cxhb1, d3cxhb2, d3cxhc1, d3cxhc2, d3cxhd1, d3cxhd2, d3cxhe1, d3cxhe2, d3cxhf1, d3cxhg_, d3cxhh_, d3cxhj_, d3cxhk_, d3cxhl1, d3cxhl2, d3cxhm1, d3cxhm2, d3cxhn1, d3cxhn2, d3cxho1, d3cxho2, d3cxhp1, d3cxhp2, d3cxhq1, d3cxhr_, d3cxhs_, d3cxhu_, d3cxhv_, d3cxhw_
   automated match to d1ezvi_
   complexed with 6ph, 7ph, 8pe, 9pe, cn6, fes, hem, sma, suc, umq

Details for d3cxht_

PDB Entry: 3cxh, 2.5 Å

PDB Description: structure of yeast complex iii with isoform-2 cytochrome c bound and definition of a minimal core interface for electron transfer.

PDB Compounds: (T:) Cytochrome b-c1 complex subunit 9

SCOPe Domain Sequences for d3cxht_:

Sequence; same for both SEQRES and ATOM records:

>d3cxht_ f.23.14.1 (T:) automated matches {Saccharomyces cerevisiae [TaxId: 559292]}
sslyktffkrnavfvgtifagafvfqtvfdtaitswyenhnkgklwkdvkariaa

Timeline for d3cxht_:

• d3cxht_ first appeared in SCOP 1.75, called d3cxht1
  
• d3cxht_ appears in SCOPe 2.01
  
• d3cxht_ appears in SCOPe 2.03
  
• d3cxht_ appears in the current release, SCOPe 2.08