SCOP 1.75: Domain d3cxhm2: 3cxh M:219-368

Lineage for d3cxhm2 (3cxh M:219-368)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
   core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta

4. Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families)
   Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues

5. Family d.185.1.1: MPP-like [63412] (6 proteins)
   Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal

6. Protein Cytochrome bc1 core subunit 2 [63409] (3 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64305] (7 PDB entries)

8. Domain d3cxhm2: 3cxh M:219-368 [157128]
   Other proteins in same PDB: d3cxha1, d3cxha2, d3cxhc1, d3cxhc2, d3cxhd1, d3cxhd2, d3cxhe1, d3cxhe2, d3cxhf1, d3cxhg1, d3cxhh1, d3cxhi1, d3cxhj1, d3cxhk1, d3cxhl1, d3cxhl2, d3cxhn1, d3cxhn2, d3cxho1, d3cxho2, d3cxhp1, d3cxhp2, d3cxhq1, d3cxhr1, d3cxhs1, d3cxht1, d3cxhu1, d3cxhv1
   automatically matched to d1ezvb2
   complexed with 6ph, 7ph, 8pe, 9pe, cn6, fes, hem, m3l, sma, suc, umq

Details for d3cxhm2

PDB Entry: 3cxh, 2.5 Å

PDB Description: structure of yeast complex iii with isoform-2 cytochrome c bound and definition of a minimal core interface for electron transfer.

PDB Compounds: (M:) Cytochrome b-c1 complex subunit 2, mitochondrial

SCOP Domain Sequences for d3cxhm2:

Sequence; same for both SEQRES and ATOM records:

>d3cxhm2 d.185.1.1 (M:219-368) Cytochrome bc1 core subunit 2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sepkfflgeenrvrfigdsvaaigipvnkaslaqyevlanyltsalselsglissakldk
ftdgglftlfvrdqdsavvssnikkivadlkkgkdlspainytklknavqnesvsspiel
nfdavkdfklgkfnyvavgdvsnlpyldel

Timeline for d3cxhm2:

• d3cxhm2 is new in SCOP 1.75
  
• d3cxhm2 appears in SCOPe 2.01
  
• d3cxhm2 appears in the current release, SCOPe 2.08