Lineage for d3cxhg_ (3cxh G:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2632997Fold f.27: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81525] (1 superfamily)
    membrane-associated alpha-helical protein; no transmembrane helices
  4. 2632998Superfamily f.27.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81524] (1 family) (S)
    location - matrix side of the bc1 complex
    automatically mapped to Pfam PF02271
  5. 2632999Family f.27.1.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81523] (2 proteins)
    probably important for the complex assembly, caps the matrix face of cytochrome b
  6. 2633029Protein automated matches [190325] (4 species)
    not a true protein
  7. 2633032Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [187309] (5 PDB entries)
  8. 2633035Domain d3cxhg_: 3cxh G: [157120]
    Other proteins in same PDB: d3cxha1, d3cxha2, d3cxhb1, d3cxhb2, d3cxhc1, d3cxhc2, d3cxhd1, d3cxhd2, d3cxhe1, d3cxhe2, d3cxhf_, d3cxhh_, d3cxhi_, d3cxhj_, d3cxhk_, d3cxhl1, d3cxhl2, d3cxhm1, d3cxhm2, d3cxhn1, d3cxhn2, d3cxho1, d3cxho2, d3cxhp1, d3cxhp2, d3cxhq_, d3cxhs_, d3cxht_, d3cxhu_, d3cxhv_, d3cxhw_
    automated match to d1ezvf_
    complexed with 6ph, 7ph, 8pe, 9pe, cn6, fes, hem, sma, suc, umq

Details for d3cxhg_

PDB Entry: 3cxh (more details), 2.5 Å

PDB Description: structure of yeast complex iii with isoform-2 cytochrome c bound and definition of a minimal core interface for electron transfer.
PDB Compounds: (G:) Cytochrome b-c1 complex subunit 7

SCOPe Domain Sequences for d3cxhg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cxhg_ f.27.1.1 (G:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
qsftsiarigdyilkspvlsklcvpvanqfinlagykklglkfddliaeenpimqtalrr
lpedesyarayriirahqtelthhllprnewikaqedvpyllpyileaeaaakekdeldn
ievsk

SCOPe Domain Coordinates for d3cxhg_:

Click to download the PDB-style file with coordinates for d3cxhg_.
(The format of our PDB-style files is described here.)

Timeline for d3cxhg_: