| Class f: Membrane and cell surface proteins and peptides [56835] (58 folds) |
| Fold f.27: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81525] (1 superfamily) membrane-associated alpha-helical protein; no transmembrane helices |
Superfamily f.27.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81524] (1 family) ![]() location - matrix side of the bc1 complex |
| Family f.27.1.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81523] (1 protein) probably important for the complex assembly, caps the matrix face of cytochrome b |
| Protein 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81522] (3 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81521] (7 PDB entries) |
| Domain d3cxhg1: 3cxh G:3-127 [157120] Other proteins in same PDB: d3cxha1, d3cxha2, d3cxhb1, d3cxhb2, d3cxhc1, d3cxhc2, d3cxhd1, d3cxhd2, d3cxhe1, d3cxhe2, d3cxhf1, d3cxhh1, d3cxhi1, d3cxhj1, d3cxhk1, d3cxhl1, d3cxhl2, d3cxhm1, d3cxhm2, d3cxhn1, d3cxhn2, d3cxho1, d3cxho2, d3cxhp1, d3cxhp2, d3cxhq1, d3cxhs1, d3cxht1, d3cxhu1, d3cxhv1 automatically matched to d1ezvf_ complexed with 6ph, 7ph, 8pe, 9pe, cn6, fes, hem, m3l, sma, suc, umq |
PDB Entry: 3cxh (more details), 2.5 Å
SCOP Domain Sequences for d3cxhg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cxhg1 f.27.1.1 (G:3-127) 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qsftsiarigdyilkspvlsklcvpvanqfinlagykklglkfddliaeenpimqtalrr
lpedesyarayriirahqtelthhllprnewikaqedvpyllpyileaeaaakekdeldn
ievsk
Timeline for d3cxhg1:
View in 3DDomains from other chains: (mouse over for more information) d3cxha1, d3cxha2, d3cxhb1, d3cxhb2, d3cxhc1, d3cxhc2, d3cxhd1, d3cxhd2, d3cxhe1, d3cxhe2, d3cxhf1, d3cxhh1, d3cxhi1, d3cxhj1, d3cxhk1, d3cxhl1, d3cxhl2, d3cxhm1, d3cxhm2, d3cxhn1, d3cxhn2, d3cxho1, d3cxho2, d3cxhp1, d3cxhp2, d3cxhq1, d3cxhr1, d3cxhs1, d3cxht1, d3cxhu1, d3cxhv1 |