SCOP 1.75: Domain d3cxhe2: 3cxh E:31-86

Lineage for d3cxhe2 (3cxh E:31-86)

1. Root: SCOP 1.75

2. Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)

3. Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
   not a true fold

4. Superfamily f.23.12: ISP transmembrane anchor [81502] (1 family)

5. Family f.23.12.1: ISP transmembrane anchor [81501] (2 proteins)

6. Protein Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region [81500] (3 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81499] (7 PDB entries)

8. Domain d3cxhe2: 3cxh E:31-86 [157118]
   Other proteins in same PDB: d3cxha1, d3cxha2, d3cxhb1, d3cxhb2, d3cxhc1, d3cxhc2, d3cxhd1, d3cxhd2, d3cxhe1, d3cxhf1, d3cxhg1, d3cxhh1, d3cxhi1, d3cxhj1, d3cxhk1, d3cxhl1, d3cxhl2, d3cxhm1, d3cxhm2, d3cxhn1, d3cxhn2, d3cxho1, d3cxho2, d3cxhp1, d3cxhq1, d3cxhr1, d3cxhs1, d3cxht1, d3cxhu1, d3cxhv1
   automatically matched to d1ezve2
   complexed with 6ph, 7ph, 8pe, 9pe, cn6, fes, hem, m3l, sma, suc, umq

Details for d3cxhe2

PDB Entry: 3cxh, 2.5 Å

PDB Description: structure of yeast complex iii with isoform-2 cytochrome c bound and definition of a minimal core interface for electron transfer.

PDB Compounds: (E:) Cytochrome b-c1 complex subunit Rieske, mitochondrial

SCOP Domain Sequences for d3cxhe2:

Sequence; same for both SEQRES and ATOM records:

>d3cxhe2 f.23.12.1 (E:31-86) Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kstyrtpnfddvlkenndadkgrsyayfmvgamgllssagakstvetfissmtata

Timeline for d3cxhe2:

• d3cxhe2 is new in SCOP 1.75
  
• d3cxhe2 appears in SCOPe 2.01
  
• d3cxhe2 appears in the current release, SCOPe 2.08