Lineage for d3cxhe1 (3cxh E:87-215)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 795913Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 795914Superfamily b.33.1: ISP domain [50022] (3 families) (S)
  5. 795915Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (8 proteins)
  6. 795938Protein ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain [50024] (3 species)
  7. 795939Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63741] (7 PDB entries)
  8. 795945Domain d3cxhe1: 3cxh E:87-215 [157117]
    Other proteins in same PDB: d3cxha1, d3cxha2, d3cxhb1, d3cxhb2, d3cxhc1, d3cxhc2, d3cxhd1, d3cxhd2, d3cxhe2, d3cxhf1, d3cxhg1, d3cxhh1, d3cxhi1, d3cxhj1, d3cxhk1, d3cxhl1, d3cxhl2, d3cxhm1, d3cxhm2, d3cxhn1, d3cxhn2, d3cxho1, d3cxho2, d3cxhp2, d3cxhq1, d3cxhr1, d3cxhs1, d3cxht1, d3cxhu1, d3cxhv1
    automatically matched to d1ezve1
    complexed with 6ph, 7ph, 8pe, 9pe, cn6, fes, hem, m3l, sma, suc, umq

Details for d3cxhe1

PDB Entry: 3cxh (more details), 2.5 Å

PDB Description: structure of yeast complex iii with isoform-2 cytochrome c bound and definition of a minimal core interface for electron transfer.
PDB Compounds: (E:) Cytochrome b-c1 complex subunit Rieske, mitochondrial

SCOP Domain Sequences for d3cxhe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cxhe1 b.33.1.1 (E:87-215) ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dvlamakvevnlaaiplgknvvvkwqgkpvfirhrtpheiqeansvdmsalkdpqtdadr
vkdpqwlimlgicthlgcvpigeagdfggwfcpchgshydisgrirkgpaplnleipaye
fdgdkvivg

SCOP Domain Coordinates for d3cxhe1:

Click to download the PDB-style file with coordinates for d3cxhe1.
(The format of our PDB-style files is described here.)

Timeline for d3cxhe1: