![]() | Class f: Membrane and cell surface proteins and peptides [56835] (58 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (38 superfamilies) not a true fold |
![]() | Superfamily f.23.14: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81514] (1 family) ![]() |
![]() | Family f.23.14.1: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81513] (1 protein) |
![]() | Protein Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81512] (3 species) interacts with cytochrome c1 and ISP |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81511] (7 PDB entries) |
![]() | Domain d3cx5t1: 3cx5 T:4-58 [157105] Other proteins in same PDB: d3cx5a1, d3cx5a2, d3cx5b1, d3cx5b2, d3cx5c1, d3cx5c2, d3cx5d1, d3cx5d2, d3cx5e1, d3cx5e2, d3cx5f1, d3cx5g1, d3cx5h1, d3cx5j1, d3cx5k1, d3cx5l1, d3cx5l2, d3cx5m1, d3cx5m2, d3cx5n1, d3cx5n2, d3cx5o1, d3cx5o2, d3cx5p1, d3cx5p2, d3cx5q1, d3cx5r1, d3cx5s1, d3cx5u1, d3cx5v1 automatically matched to d1ezvi_ complexed with 6ph, 7ph, 8pe, 9pe, cn3, cn5, fes, hem, m3l, sma, suc, umq |
PDB Entry: 3cx5 (more details), 1.9 Å
SCOP Domain Sequences for d3cx5t1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cx5t1 f.23.14.1 (T:4-58) Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} sslyktffkrnavfvgtifagafvfqtvfdtaitswyenhnkgklwkdvkariaa
Timeline for d3cx5t1:
![]() Domains from other chains: (mouse over for more information) d3cx5a1, d3cx5a2, d3cx5b1, d3cx5b2, d3cx5c1, d3cx5c2, d3cx5d1, d3cx5d2, d3cx5e1, d3cx5e2, d3cx5f1, d3cx5g1, d3cx5h1, d3cx5i1, d3cx5j1, d3cx5k1, d3cx5l1, d3cx5l2, d3cx5m1, d3cx5m2, d3cx5n1, d3cx5n2, d3cx5o1, d3cx5o2, d3cx5p1, d3cx5p2, d3cx5q1, d3cx5r1, d3cx5s1, d3cx5u1, d3cx5v1 |