![]() | Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
![]() | Fold f.27: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81525] (1 superfamily) membrane-associated alpha-helical protein; no transmembrane helices |
![]() | Superfamily f.27.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81524] (1 family) ![]() location - matrix side of the bc1 complex automatically mapped to Pfam PF02271 |
![]() | Family f.27.1.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81523] (2 proteins) probably important for the complex assembly, caps the matrix face of cytochrome b |
![]() | Protein automated matches [190325] (4 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [187309] (3 PDB entries) |
![]() | Domain d3cx5r_: 3cx5 R: [157103] Other proteins in same PDB: d3cx5a1, d3cx5a2, d3cx5b1, d3cx5b2, d3cx5c1, d3cx5c2, d3cx5d1, d3cx5d2, d3cx5e1, d3cx5e2, d3cx5f_, d3cx5h_, d3cx5i_, d3cx5j_, d3cx5k_, d3cx5l1, d3cx5l2, d3cx5m1, d3cx5m2, d3cx5n1, d3cx5n2, d3cx5o1, d3cx5o2, d3cx5p1, d3cx5p2, d3cx5q_, d3cx5s_, d3cx5t_, d3cx5u_, d3cx5v_, d3cx5w_ automated match to d1ezvf_ complexed with 6ph, 7ph, 8pe, 9pe, cn3, cn5, fes, hem, sma, suc, umq |
PDB Entry: 3cx5 (more details), 1.9 Å
SCOPe Domain Sequences for d3cx5r_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cx5r_ f.27.1.1 (R:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} pqsftsiarigdyilkspvlsklcvpvanqfinlagykklglkfddliaeenpimqtalr rlpedesyarayriirahqtelthhllprnewikaqedvpyllpyileaeaaakekdeld nievsk
Timeline for d3cx5r_:
![]() Domains from other chains: (mouse over for more information) d3cx5a1, d3cx5a2, d3cx5b1, d3cx5b2, d3cx5c1, d3cx5c2, d3cx5d1, d3cx5d2, d3cx5e1, d3cx5e2, d3cx5f_, d3cx5g_, d3cx5h_, d3cx5i_, d3cx5j_, d3cx5k_, d3cx5l1, d3cx5l2, d3cx5m1, d3cx5m2, d3cx5n1, d3cx5n2, d3cx5o1, d3cx5o2, d3cx5p1, d3cx5p2, d3cx5q_, d3cx5s_, d3cx5t_, d3cx5u_, d3cx5v_, d3cx5w_ |