SCOPe 2.04: Domain d3cx5q_: 3cx5 Q:

Lineage for d3cx5q_ (3cx5 Q:)

1. Root: SCOPe 2.04

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.28: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81532] (1 superfamily)
   membrane-associated alpha-helical protein; no transmembrane helices

4. Superfamily f.28.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81531] (1 family)
   location - intermembrane side of the bc1 complex
   automatically mapped to Pfam PF02320

5. Family f.28.1.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81530] (2 proteins)
   "acidic/hinge protein", essential for the complex formation, interacts with the functional domain of cytochrome c1

6. Protein automated matches [190042] (3 species)
   not a true protein

7. Species Saccharomyces cerevisiae [TaxId:764097] [255784] (2 PDB entries)

8. Domain d3cx5q_: 3cx5 Q: [157102]
   Other proteins in same PDB: d3cx5a1, d3cx5a2, d3cx5b1, d3cx5b2, d3cx5c1, d3cx5c2, d3cx5d1, d3cx5d2, d3cx5e1, d3cx5e2, d3cx5g_, d3cx5h_, d3cx5i_, d3cx5j_, d3cx5k_, d3cx5l1, d3cx5l2, d3cx5m1, d3cx5m2, d3cx5n1, d3cx5n2, d3cx5o1, d3cx5o2, d3cx5p1, d3cx5p2, d3cx5r_, d3cx5s_, d3cx5t_, d3cx5u_, d3cx5v_, d3cx5w_
   automated match to d3cx5q1
   complexed with 6ph, 7ph, 8pe, 9pe, cn3, cn5, fes, hem, sma, suc, umq

Details for d3cx5q_

PDB Entry: 3cx5, 1.9 Å

PDB Description: structure of complex iii with bound cytochrome c in reduced state and definition of a minimal core interface for electron transfer.

PDB Compounds: (Q:) Cytochrome b-c1 complex subunit 6

SCOPe Domain Sequences for d3cx5q_:

Sequence; same for both SEQRES and ATOM records:

>d3cx5q_ f.28.1.1 (Q:) automated matches {Saccharomyces cerevisiae}
vtdqledlrehfknteegkalvhhyeecaervkiqqqqpgyadlehkedcveeffhlqhy
ldtataprlfdklk

Timeline for d3cx5q_:

• d3cx5q_ first appeared in SCOP 1.75, called d3cx5q1
  
• d3cx5q_ was called d3cx5q1 in SCOPe 2.03
  
• d3cx5q_ appears in SCOPe 2.05
  
• d3cx5q_ appears in the current release, SCOPe 2.08