SCOP 1.75: Domain d3cx5p1: 3cx5 P:87-215

Lineage for d3cx5p1 (3cx5 P:87-215)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.33: ISP domain [50021] (1 superfamily)
   consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)

4. Superfamily b.33.1: ISP domain [50022] (3 families)

5. Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (8 proteins)

6. Protein ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain [50024] (3 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63741] (7 PDB entries)

8. Domain d3cx5p1: 3cx5 P:87-215 [157100]
   Other proteins in same PDB: d3cx5a1, d3cx5a2, d3cx5b1, d3cx5b2, d3cx5c1, d3cx5c2, d3cx5d1, d3cx5d2, d3cx5e2, d3cx5f1, d3cx5g1, d3cx5h1, d3cx5i1, d3cx5j1, d3cx5k1, d3cx5l1, d3cx5l2, d3cx5m1, d3cx5m2, d3cx5n1, d3cx5n2, d3cx5o1, d3cx5o2, d3cx5p2, d3cx5q1, d3cx5r1, d3cx5s1, d3cx5t1, d3cx5u1, d3cx5v1
   automatically matched to d1ezve1
   complexed with 6ph, 7ph, 8pe, 9pe, cn3, cn5, fes, hem, m3l, sma, suc, umq

Details for d3cx5p1

PDB Entry: 3cx5, 1.9 Å

PDB Description: structure of complex iii with bound cytochrome c in reduced state and definition of a minimal core interface for electron transfer.

PDB Compounds: (P:) Cytochrome b-c1 complex subunit Rieske, mitochondrial

SCOP Domain Sequences for d3cx5p1:

Sequence; same for both SEQRES and ATOM records:

>d3cx5p1 b.33.1.1 (P:87-215) ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dvlamakvevnlaaiplgknvvvkwqgkpvfirhrtpheiqeansvdmsalkdpqtdadr
vkdpqwlimlgicthlgcvpigeagdfggwfcpchgshydisgrirkgpaplnleipaye
fdgdkvivg

Timeline for d3cx5p1:

• d3cx5p1 is new in SCOP 1.75
  
• d3cx5p1 appears in SCOPe 2.01
  
• d3cx5p1 appears in the current release, SCOPe 2.08