Details for d3cx5o2

PDB Entry: 3cx5 (more details), 1.9 Å

PDB Description: structure of complex iii with bound cytochrome c in reduced state and definition of a minimal core interface for electron transfer.
PDB Compounds: (O:) Cytochrome c1, heme protein, mitochondrial

SCOPe Domain Sequences for d3cx5o2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cx5o2 f.23.11.1 (O:261-309) Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pehderkrlglktviilsslyllsiwvkkfkwagiktrkfvfnppkprk

SCOPe Domain Coordinates for d3cx5o2:

Click to download the PDB-style file with coordinates for d3cx5o2.
(The format of our PDB-style files is described here.)

Timeline for d3cx5o2: