Class f: Membrane and cell surface proteins and peptides [56835] (58 folds) |
Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies) core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices |
Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families) Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically |
Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (2 proteins) a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria |
Protein Mitochondrial cytochrome b subunit, N-terminal domain [81641] (3 species) also includes extra transmembrane (linker) helix absent in plants and cyanobacteria subunits |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81640] (7 PDB entries) |
Domain d3cx5n2: 3cx5 N:1-261 [157097] Other proteins in same PDB: d3cx5a1, d3cx5a2, d3cx5b1, d3cx5b2, d3cx5c1, d3cx5d1, d3cx5d2, d3cx5e1, d3cx5e2, d3cx5f1, d3cx5g1, d3cx5h1, d3cx5i1, d3cx5j1, d3cx5k1, d3cx5l1, d3cx5l2, d3cx5m1, d3cx5m2, d3cx5n1, d3cx5o1, d3cx5o2, d3cx5p1, d3cx5p2, d3cx5q1, d3cx5r1, d3cx5s1, d3cx5t1, d3cx5u1, d3cx5v1 automatically matched to d1ezvc3 complexed with 6ph, 7ph, 8pe, 9pe, cn3, cn5, fes, hem, m3l, sma, suc, umq |
PDB Entry: 3cx5 (more details), 1.9 Å
SCOP Domain Sequences for d3cx5n2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cx5n2 f.21.1.2 (N:1-261) Mitochondrial cytochrome b subunit, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} mafrksnvylslvnsyiidspqpssinywwnmgsllglclviqivtgifmamhyssniel afssvehimrdvhngyilrylhangasfffmvmfmhmakglyygsyrsprvtlwnvgvii filtiataflgyccvygqmshwgatvitnlfsaipfvgndivswlwggfsvsnptiqrff alhylvpfiiaamvimhlmalhihgssnplgitgnldripmhsyfifkdlvtvflfmlil alfvfyspntlghpdnyipgn
Timeline for d3cx5n2:
View in 3D Domains from other chains: (mouse over for more information) d3cx5a1, d3cx5a2, d3cx5b1, d3cx5b2, d3cx5c1, d3cx5c2, d3cx5d1, d3cx5d2, d3cx5e1, d3cx5e2, d3cx5f1, d3cx5g1, d3cx5h1, d3cx5i1, d3cx5j1, d3cx5k1, d3cx5l1, d3cx5l2, d3cx5m1, d3cx5m2, d3cx5o1, d3cx5o2, d3cx5p1, d3cx5p2, d3cx5q1, d3cx5r1, d3cx5s1, d3cx5t1, d3cx5u1, d3cx5v1 |