SCOPe 2.04: Domain d3cx5n1: 3cx5 N:262-385

Lineage for d3cx5n1 (3cx5 N:262-385)

1. Root: SCOPe 2.04

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily)
   core: three transmembrane helices, up-and-down bundle

4. Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (2 families)

5. Family f.32.1.0: automated matches [254197] (1 protein)
   not a true family

6. Protein automated matches [254431] (4 species)
   not a true protein

7. Species Saccharomyces cerevisiae [TaxId:764097] [255786] (2 PDB entries)

8. Domain d3cx5n1: 3cx5 N:262-385 [157096]
   Other proteins in same PDB: d3cx5a1, d3cx5a2, d3cx5b1, d3cx5b2, d3cx5c2, d3cx5d1, d3cx5d2, d3cx5e1, d3cx5e2, d3cx5f_, d3cx5g_, d3cx5h_, d3cx5i_, d3cx5j_, d3cx5k_, d3cx5l1, d3cx5l2, d3cx5m1, d3cx5m2, d3cx5n2, d3cx5o1, d3cx5o2, d3cx5p1, d3cx5p2, d3cx5q_, d3cx5r_, d3cx5s_, d3cx5t_, d3cx5u_, d3cx5v_, d3cx5w_
   automated match to d3cx5n1
   complexed with 6ph, 7ph, 8pe, 9pe, cn3, cn5, fes, hem, sma, suc, umq

Details for d3cx5n1

PDB Entry: 3cx5, 1.9 Å

PDB Description: structure of complex iii with bound cytochrome c in reduced state and definition of a minimal core interface for electron transfer.

PDB Compounds: (N:) cytochrome b

SCOPe Domain Sequences for d3cx5n1:

Sequence; same for both SEQRES and ATOM records:

>d3cx5n1 f.32.1.0 (N:262-385) automated matches {Saccharomyces cerevisiae}
plvtpasivpewyllpfyailrsipdkllgvitmfaailvllvlpftdrsvvrgntfkvl
skffffifvfnfvllgqigachvevpyvlmgqiatfiyfayfliivpvistienvlfyig
rvnk

Timeline for d3cx5n1:

• d3cx5n1 first appeared in SCOP 1.75
  
• d3cx5n1 appears in SCOPe 2.03
  
• d3cx5n1 appears in SCOPe 2.05
  
• d3cx5n1 appears in the current release, SCOPe 2.08