SCOP 1.75: Domain d3cx5m1: 3cx5 M:17-218

Lineage for d3cx5m1 (3cx5 M:17-218)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
   core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta

4. Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families)
   Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues

5. Family d.185.1.1: MPP-like [63412] (6 proteins)
   Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal

6. Protein Cytochrome bc1 core subunit 2 [63409] (3 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64305] (7 PDB entries)

8. Domain d3cx5m1: 3cx5 M:17-218 [157094]
   Other proteins in same PDB: d3cx5a1, d3cx5a2, d3cx5c1, d3cx5c2, d3cx5d1, d3cx5d2, d3cx5e1, d3cx5e2, d3cx5f1, d3cx5g1, d3cx5h1, d3cx5i1, d3cx5j1, d3cx5k1, d3cx5l1, d3cx5l2, d3cx5n1, d3cx5n2, d3cx5o1, d3cx5o2, d3cx5p1, d3cx5p2, d3cx5q1, d3cx5r1, d3cx5s1, d3cx5t1, d3cx5u1, d3cx5v1
   automatically matched to d1ezvb1
   complexed with 6ph, 7ph, 8pe, 9pe, cn3, cn5, fes, hem, m3l, sma, suc, umq

Details for d3cx5m1

PDB Entry: 3cx5, 1.9 Å

PDB Description: structure of complex iii with bound cytochrome c in reduced state and definition of a minimal core interface for electron transfer.

PDB Compounds: (M:) Cytochrome b-c1 complex subunit 2, mitochondrial

SCOP Domain Sequences for d3cx5m1:

Sequence; same for both SEQRES and ATOM records:

>d3cx5m1 d.185.1.1 (M:17-218) Cytochrome bc1 core subunit 2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ltvsardaptkistlavkvhggsryatkdgvahllnrfnfqntntrsalklvresellgg
tfkstldreyitlkatflkddlpyyvnaladvlyktafkpheltesvlpaarydyavaeq
cpvksaedqlyaitfrkglgnpllydgvervslqdikdfadkvytkenlevsgenvvead
lkrfvdesllstlpagkslvsk

Timeline for d3cx5m1:

• d3cx5m1 is new in SCOP 1.75
  
• d3cx5m1 appears in SCOPe 2.01
  
• d3cx5m1 appears in the current release, SCOPe 2.08