Lineage for d3cx5l1 (3cx5 L:27-239)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1049845Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
    core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta
  4. 1049846Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families) (S)
    Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues
  5. 1049847Family d.185.1.1: MPP-like [63412] (6 proteins)
    Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal
  6. 1049848Protein Cytochrome bc1 core subunit 1 [63408] (3 species)
  7. 1049849Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64304] (7 PDB entries)
  8. 1049852Domain d3cx5l1: 3cx5 L:27-239 [157092]
    Other proteins in same PDB: d3cx5b1, d3cx5b2, d3cx5c1, d3cx5c2, d3cx5d1, d3cx5d2, d3cx5e1, d3cx5e2, d3cx5f1, d3cx5g_, d3cx5h_, d3cx5i_, d3cx5j_, d3cx5k_, d3cx5m1, d3cx5m2, d3cx5n1, d3cx5n2, d3cx5o1, d3cx5o2, d3cx5p1, d3cx5p2, d3cx5q1, d3cx5r_, d3cx5s_, d3cx5t_, d3cx5u_, d3cx5v_, d3cx5w_
    automatically matched to d1kb9a1
    complexed with 6ph, 7ph, 8pe, 9pe, cn3, cn5, fes, hem, sma, suc, umq

Details for d3cx5l1

PDB Entry: 3cx5 (more details), 1.9 Å

PDB Description: structure of complex iii with bound cytochrome c in reduced state and definition of a minimal core interface for electron transfer.
PDB Compounds: (L:) Cytochrome b-c1 complex subunit 1, mitochondrial

SCOPe Domain Sequences for d3cx5l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cx5l1 d.185.1.1 (L:27-239) Cytochrome bc1 core subunit 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
aevtqlsngivvatehnpsahtasvgvvfgsgaanenpynngvsnlwkniflskensava
akeglalssnisrdfqsyivsslpgstdksldflnqsfiqqkanllsssnfeatkksvlk
qvqdfedndhpnrvlehlhstafqntplslptrgtleslenlvvadlesfannhflnsna
vvvgtgnikhedlvnsiesknlslqtgtkpvlk

SCOPe Domain Coordinates for d3cx5l1:

Click to download the PDB-style file with coordinates for d3cx5l1.
(The format of our PDB-style files is described here.)

Timeline for d3cx5l1: