Lineage for d3cx5i_ (3cx5 I:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2253581Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2254512Superfamily f.23.14: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81514] (1 family) (S)
    automatically mapped to Pfam PF05365
  5. 2254513Family f.23.14.1: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81513] (2 proteins)
  6. 2254549Protein automated matches [190326] (3 species)
    not a true protein
  7. 2254552Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [187308] (3 PDB entries)
  8. 2254553Domain d3cx5i_: 3cx5 I: [157089]
    Other proteins in same PDB: d3cx5a1, d3cx5a2, d3cx5b1, d3cx5b2, d3cx5c1, d3cx5c2, d3cx5d1, d3cx5d2, d3cx5e1, d3cx5e2, d3cx5f_, d3cx5g_, d3cx5h_, d3cx5j_, d3cx5k_, d3cx5l1, d3cx5l2, d3cx5m1, d3cx5m2, d3cx5n1, d3cx5n2, d3cx5o1, d3cx5o2, d3cx5p1, d3cx5p2, d3cx5q_, d3cx5r_, d3cx5s_, d3cx5u_, d3cx5v_, d3cx5w_
    automated match to d1ezvi_
    complexed with 6ph, 7ph, 8pe, 9pe, cn3, cn5, fes, hem, sma, suc, umq

Details for d3cx5i_

PDB Entry: 3cx5 (more details), 1.9 Å

PDB Description: structure of complex iii with bound cytochrome c in reduced state and definition of a minimal core interface for electron transfer.
PDB Compounds: (I:) Cytochrome b-c1 complex subunit 9

SCOPe Domain Sequences for d3cx5i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cx5i_ f.23.14.1 (I:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
sfsslyktffkrnavfvgtifagafvfqtvfdtaitswyenhnkgklwkdvkariaa

SCOPe Domain Coordinates for d3cx5i_:

Click to download the PDB-style file with coordinates for d3cx5i_.
(The format of our PDB-style files is described here.)

Timeline for d3cx5i_: