Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.23: Single transmembrane helix [81407] (38 superfamilies) not a true fold |
Superfamily f.23.14: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81514] (1 family) |
Family f.23.14.1: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81513] (2 proteins) |
Protein automated matches [190326] (3 species) not a true protein |
Species Saccharomyces cerevisiae [TaxId:559292] [187308] (2 PDB entries) |
Domain d3cx5i_: 3cx5 I: [157089] Other proteins in same PDB: d3cx5a1, d3cx5a2, d3cx5b1, d3cx5b2, d3cx5c1, d3cx5c2, d3cx5d1, d3cx5d2, d3cx5e1, d3cx5e2, d3cx5f1, d3cx5g_, d3cx5h_, d3cx5j_, d3cx5k_, d3cx5l1, d3cx5l2, d3cx5m1, d3cx5m2, d3cx5n1, d3cx5n2, d3cx5o1, d3cx5o2, d3cx5p1, d3cx5p2, d3cx5q1, d3cx5r_, d3cx5s_, d3cx5u_, d3cx5v_, d3cx5w_ automated match to d1ezvi_ complexed with 6ph, 7ph, 8pe, 9pe, cn3, cn5, fes, hem, sma, suc, umq |
PDB Entry: 3cx5 (more details), 1.9 Å
SCOPe Domain Sequences for d3cx5i_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cx5i_ f.23.14.1 (I:) automated matches {Saccharomyces cerevisiae [TaxId: 559292]} sfsslyktffkrnavfvgtifagafvfqtvfdtaitswyenhnkgklwkdvkariaa
Timeline for d3cx5i_:
View in 3D Domains from other chains: (mouse over for more information) d3cx5a1, d3cx5a2, d3cx5b1, d3cx5b2, d3cx5c1, d3cx5c2, d3cx5d1, d3cx5d2, d3cx5e1, d3cx5e2, d3cx5f1, d3cx5g_, d3cx5h_, d3cx5j_, d3cx5k_, d3cx5l1, d3cx5l2, d3cx5m1, d3cx5m2, d3cx5n1, d3cx5n2, d3cx5o1, d3cx5o2, d3cx5p1, d3cx5p2, d3cx5q1, d3cx5r_, d3cx5s_, d3cx5t_, d3cx5u_, d3cx5v_, d3cx5w_ |