Lineage for d3cx5h_ (3cx5 H:)

  1. Root: SCOPe 2.04
  2. 1695624Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1697651Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 1698346Superfamily f.23.13: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81508] (1 family) (S)
    automatically mapped to Pfam PF02939
  5. 1698347Family f.23.13.1: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81507] (2 proteins)
  6. 1698348Protein Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81506] (3 species)
    together with cytochrome b binds to ubiquinone
  7. 1698349Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81505] (8 PDB entries)
  8. 1698350Domain d3cx5h_: 3cx5 H: [157088]
    Other proteins in same PDB: d3cx5a1, d3cx5a2, d3cx5b1, d3cx5b2, d3cx5c1, d3cx5c2, d3cx5d1, d3cx5d2, d3cx5e1, d3cx5e2, d3cx5f_, d3cx5g_, d3cx5i_, d3cx5j_, d3cx5k_, d3cx5l1, d3cx5l2, d3cx5m1, d3cx5m2, d3cx5n1, d3cx5n2, d3cx5o1, d3cx5o2, d3cx5p1, d3cx5p2, d3cx5q_, d3cx5r_, d3cx5t_, d3cx5u_, d3cx5v_, d3cx5w_
    automated match to d1ezvg_
    complexed with 6ph, 7ph, 8pe, 9pe, cn3, cn5, fes, hem, sma, suc, umq

Details for d3cx5h_

PDB Entry: 3cx5 (more details), 1.9 Å

PDB Description: structure of complex iii with bound cytochrome c in reduced state and definition of a minimal core interface for electron transfer.
PDB Compounds: (H:) Cytochrome b-c1 complex subunit 8

SCOPe Domain Sequences for d3cx5h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cx5h_ f.23.13.1 (H:) Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gppsgktymgwwghmggpkqkgitsyavspyaqkplqgifhnavfnsfrrfksqflyvli
pagiywywwkngneyneflyskagreelervnv

SCOPe Domain Coordinates for d3cx5h_:

Click to download the PDB-style file with coordinates for d3cx5h_.
(The format of our PDB-style files is described here.)

Timeline for d3cx5h_: