Lineage for d3cx5g_ (3cx5 G:)

  1. Root: SCOPe 2.04
  2. 1695624Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1699236Fold f.27: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81525] (1 superfamily)
    membrane-associated alpha-helical protein; no transmembrane helices
  4. 1699237Superfamily f.27.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81524] (1 family) (S)
    location - matrix side of the bc1 complex
    automatically mapped to Pfam PF02271
  5. 1699238Family f.27.1.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81523] (2 proteins)
    probably important for the complex assembly, caps the matrix face of cytochrome b
  6. 1699268Protein automated matches [190325] (4 species)
    not a true protein
  7. 1699271Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [187309] (3 PDB entries)
  8. 1699272Domain d3cx5g_: 3cx5 G: [157087]
    Other proteins in same PDB: d3cx5a1, d3cx5a2, d3cx5b1, d3cx5b2, d3cx5c1, d3cx5c2, d3cx5d1, d3cx5d2, d3cx5e1, d3cx5e2, d3cx5f_, d3cx5h_, d3cx5i_, d3cx5j_, d3cx5k_, d3cx5l1, d3cx5l2, d3cx5m1, d3cx5m2, d3cx5n1, d3cx5n2, d3cx5o1, d3cx5o2, d3cx5p1, d3cx5p2, d3cx5q_, d3cx5s_, d3cx5t_, d3cx5u_, d3cx5v_, d3cx5w_
    automated match to d1ezvf_
    complexed with 6ph, 7ph, 8pe, 9pe, cn3, cn5, fes, hem, sma, suc, umq

Details for d3cx5g_

PDB Entry: 3cx5 (more details), 1.9 Å

PDB Description: structure of complex iii with bound cytochrome c in reduced state and definition of a minimal core interface for electron transfer.
PDB Compounds: (G:) Cytochrome b-c1 complex subunit 7

SCOPe Domain Sequences for d3cx5g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cx5g_ f.27.1.1 (G:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
pqsftsiarigdyilkspvlsklcvpvanqfinlagykklglkfddliaeenpimqtalr
rlpedesyarayriirahqtelthhllprnewikaqedvpyllpyileaeaaakekdeld
nievsk

SCOPe Domain Coordinates for d3cx5g_:

Click to download the PDB-style file with coordinates for d3cx5g_.
(The format of our PDB-style files is described here.)

Timeline for d3cx5g_: