Lineage for d3cx5f1 (3cx5 F:74-147)

  1. Root: SCOPe 2.01
  2. 1058004Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1060677Fold f.28: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81532] (1 superfamily)
    membrane-associated alpha-helical protein; no transmembrane helices
  4. 1060678Superfamily f.28.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81531] (1 family) (S)
    location - intermembrane side of the bc1 complex
  5. 1060679Family f.28.1.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81530] (2 proteins)
    "acidic/hinge protein", essential for the complex formation, interacts with the functional domain of cytochrome c1
  6. 1060680Protein Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81529] (3 species)
  7. 1060681Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81528] (7 PDB entries)
  8. 1060682Domain d3cx5f1: 3cx5 F:74-147 [157086]
    Other proteins in same PDB: d3cx5a1, d3cx5a2, d3cx5b1, d3cx5b2, d3cx5c1, d3cx5c2, d3cx5d1, d3cx5d2, d3cx5e1, d3cx5e2, d3cx5g_, d3cx5h_, d3cx5i_, d3cx5j_, d3cx5k_, d3cx5l1, d3cx5l2, d3cx5m1, d3cx5m2, d3cx5n1, d3cx5n2, d3cx5o1, d3cx5o2, d3cx5p1, d3cx5p2, d3cx5r_, d3cx5s_, d3cx5t_, d3cx5u_, d3cx5v_, d3cx5w_
    automatically matched to d1ezvh_
    complexed with 6ph, 7ph, 8pe, 9pe, cn3, cn5, fes, hem, sma, suc, umq

Details for d3cx5f1

PDB Entry: 3cx5 (more details), 1.9 Å

PDB Description: Structure of complex III with bound cytochrome c in reduced state and definition of a minimal core interface for electron transfer.
PDB Compounds: (F:) Cytochrome b-c1 complex subunit 6

SCOPe Domain Sequences for d3cx5f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cx5f1 f.28.1.1 (F:74-147) Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vtdqledlrehfknteegkalvhhyeecaervkiqqqqpgyadlehkedcveeffhlqhy
ldtataprlfdklk

SCOPe Domain Coordinates for d3cx5f1:

Click to download the PDB-style file with coordinates for d3cx5f1.
(The format of our PDB-style files is described here.)

Timeline for d3cx5f1: