![]() | Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (38 superfamilies) not a true fold |
![]() | Superfamily f.23.11: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81496] (2 families) ![]() |
![]() | Family f.23.11.1: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81495] (1 protein) |
![]() | Protein Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81494] (3 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81493] (7 PDB entries) |
![]() | Domain d3cx5d2: 3cx5 D:261-309 [157083] Other proteins in same PDB: d3cx5a1, d3cx5a2, d3cx5b1, d3cx5b2, d3cx5c1, d3cx5c2, d3cx5d1, d3cx5e1, d3cx5e2, d3cx5f1, d3cx5g_, d3cx5h_, d3cx5i_, d3cx5j_, d3cx5k_, d3cx5l1, d3cx5l2, d3cx5m1, d3cx5m2, d3cx5n1, d3cx5n2, d3cx5o1, d3cx5p1, d3cx5p2, d3cx5q1, d3cx5r_, d3cx5s_, d3cx5t_, d3cx5u_, d3cx5v_, d3cx5w_ automated match to d1kyod2 complexed with 6ph, 7ph, 8pe, 9pe, cn3, cn5, fes, hem, sma, suc, umq |
PDB Entry: 3cx5 (more details), 1.9 Å
SCOPe Domain Sequences for d3cx5d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cx5d2 f.23.11.1 (D:261-309) Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} pehderkrlglktviilsslyllsiwvkkfkwagiktrkfvfnppkprk
Timeline for d3cx5d2:
![]() Domains from other chains: (mouse over for more information) d3cx5a1, d3cx5a2, d3cx5b1, d3cx5b2, d3cx5c1, d3cx5c2, d3cx5e1, d3cx5e2, d3cx5f1, d3cx5g_, d3cx5h_, d3cx5i_, d3cx5j_, d3cx5k_, d3cx5l1, d3cx5l2, d3cx5m1, d3cx5m2, d3cx5n1, d3cx5n2, d3cx5o1, d3cx5o2, d3cx5p1, d3cx5p2, d3cx5q1, d3cx5r_, d3cx5s_, d3cx5t_, d3cx5u_, d3cx5v_, d3cx5w_ |