Lineage for d3cx5d2 (3cx5 D:261-307)

  1. Root: SCOP 1.75
  2. 886031Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)
  3. 887128Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 887437Superfamily f.23.11: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81496] (1 family) (S)
  5. 887438Family f.23.11.1: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81495] (1 protein)
  6. 887439Protein Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81494] (3 species)
  7. 887440Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81493] (7 PDB entries)
  8. 887441Domain d3cx5d2: 3cx5 D:261-307 [157083]
    Other proteins in same PDB: d3cx5a1, d3cx5a2, d3cx5b1, d3cx5b2, d3cx5c1, d3cx5c2, d3cx5d1, d3cx5e1, d3cx5e2, d3cx5f1, d3cx5g1, d3cx5h1, d3cx5i1, d3cx5j1, d3cx5k1, d3cx5l1, d3cx5l2, d3cx5m1, d3cx5m2, d3cx5n1, d3cx5n2, d3cx5o1, d3cx5p1, d3cx5p2, d3cx5q1, d3cx5r1, d3cx5s1, d3cx5t1, d3cx5u1, d3cx5v1
    automatically matched to d1kb9d2
    complexed with 6ph, 7ph, 8pe, 9pe, cn3, cn5, fes, hem, m3l, sma, suc, umq

Details for d3cx5d2

PDB Entry: 3cx5 (more details), 1.9 Å

PDB Description: Structure of complex III with bound cytochrome c in reduced state and definition of a minimal core interface for electron transfer.
PDB Compounds: (D:) Cytochrome c1, heme protein, mitochondrial

SCOP Domain Sequences for d3cx5d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cx5d2 f.23.11.1 (D:261-307) Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pehderkrlglktviilsslyllsiwvkkfkwagiktrkfvfnppkp

SCOP Domain Coordinates for d3cx5d2:

Click to download the PDB-style file with coordinates for d3cx5d2.
(The format of our PDB-style files is described here.)

Timeline for d3cx5d2: