| Root: SCOP 1.73 |
| Class a: All alpha proteins [46456] (258 folds) |
| Fold a.2: Long alpha-hairpin [46556] (19 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.6: HR1 repeat [46585] (1 family) ![]() |
| Family a.2.6.1: HR1 repeat [46586] (1 protein) protein kinase effector domain this is a repeat family; one repeat unit is 1urf A:122-199 found in domain |
| Protein Protein kinase c-like 1, pkn/prk1 [46587] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [46588] (2 PDB entries) |
| Domain d1cxzb_: 1cxz B: [15705] Other proteins in same PDB: d1cxza_ first HR1 domain complexed with RhoA complexed with gsp, mg; mutant |
PDB Entry: 1cxz (more details), 2.2 Å
SCOP Domain Sequences for d1cxzb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cxzb_ a.2.6.1 (B:) Protein kinase c-like 1, pkn/prk1 {Human (Homo sapiens) [TaxId: 9606]}
wslleqlglagadlaapgvqqqlelererlrreirkelklkegaenlrrattdlgrslgp
velllrgssrrldllhqqlqelhahv
Timeline for d1cxzb_: