SCOP 1.71: Domain d1cxzb_: 1cxz B:

Lineage for d1cxzb_ (1cxz B:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.2: Long alpha-hairpin [46556] (13 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.6: HR1 repeat [46585] (1 family)

5. Family a.2.6.1: HR1 repeat [46586] (1 protein)
   protein kinase effector domain
   this is a repeat family; one repeat unit is 1urf A:122-199 found in domain

6. Protein Protein kinase c-like 1, pkn/prk1 [46587] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46588] (2 PDB entries)

8. Domain d1cxzb_: 1cxz B: [15705]
   Other proteins in same PDB: d1cxza_
   first HR1 domain complexed with RhoA
   complexed with gsp, mg; mutant

Details for d1cxzb_

PDB Entry: 1cxz, 2.2 Å

PDB Description: crystal structure of human rhoa complexed with the effector domain of the protein kinase pkn/prk1

SCOP Domain Sequences for d1cxzb_:

Sequence; same for both SEQRES and ATOM records:

>d1cxzb_ a.2.6.1 (B:) Protein kinase c-like 1, pkn/prk1 {Human (Homo sapiens)}
wslleqlglagadlaapgvqqqlelererlrreirkelklkegaenlrrattdlgrslgp
velllrgssrrldllhqqlqelhahv

Timeline for d1cxzb_:

• d1cxzb_ first appeared (with stable ids) in SCOP 1.55
  
• d1cxzb_ appears in SCOP 1.69
  
• d1cxzb_ appears in SCOP 1.73
  
• d1cxzb_ appears in the current release, SCOPe 2.08