Lineage for d3cwbp2 (3cwb P:2-261)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024525Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
    core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices
  4. 3024526Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families) (S)
    Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically
  5. 3024532Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (3 proteins)
    a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria
  6. 3024543Protein Mitochondrial cytochrome b subunit, N-terminal domain [81641] (3 species)
    also includes extra transmembrane (linker) helix absent in plants and cyanobacteria subunits
  7. 3024551Species Chicken (Gallus gallus) [TaxId:9031] [81639] (8 PDB entries)
  8. 3024562Domain d3cwbp2: 3cwb P:2-261 [157048]
    Other proteins in same PDB: d3cwbc1, d3cwbp1
    automatically matched to d1bccc3
    complexed with azi, bog, cdl, fes, hec, hem, icx, pee, unl, uq

Details for d3cwbp2

PDB Entry: 3cwb (more details), 3.51 Å

PDB Description: chicken cytochrome bc1 complex inhibited by an iodinated analogue of the polyketide crocacin-d
PDB Compounds: (P:) cytochrome b

SCOPe Domain Sequences for d3cwbp2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cwbp2 f.21.1.2 (P:2-261) Mitochondrial cytochrome b subunit, N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
apnirkshpllkminnslidlpapsnisawwnfgsllavclmtqiltglllamhytadts
lafssvahtcrnvqygwlirnlhangasffficiflhigrglyygsylyketwntgvill
ltlmatafvgyvlpwgqmsfwgatvitnlfsaipyightlvewawggfsvdnptltrffa
lhfllpfaiagitiihltflhesgsnnplgissdsdkipfhpyysfkdilgltlmltpfl
tlalfspnllgdpenftpan

SCOPe Domain Coordinates for d3cwbp2:

Click to download the PDB-style file with coordinates for d3cwbp2.
(The format of our PDB-style files is described here.)

Timeline for d3cwbp2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3cwbp1