Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds) |
Fold e.23: Acetyl-CoA synthetase-like [56800] (1 superfamily) 4 domains: (1&2) duplication: share the same alpha/beta fold; (3) beta-barrel; (4) alpha+beta |
Superfamily e.23.1: Acetyl-CoA synthetase-like [56801] (2 families) |
Family e.23.1.1: Acetyl-CoA synthetase-like [56802] (7 proteins) |
Protein 4-chlorobenzoyl CoA ligase [111316] (1 species) |
Species Alcaligenes sp. AL3007 [TaxId:206162] [111317] (9 PDB entries) Uniprot Q8GN86 |
Domain d3cw9b_: 3cw9 B: [157036] automated match to d1t5dx_ complexed with 01a, amp, edo, mg, no3 |
PDB Entry: 3cw9 (more details), 2 Å
SCOPe Domain Sequences for d3cw9b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cw9b_ e.23.1.1 (B:) 4-chlorobenzoyl CoA ligase {Alcaligenes sp. AL3007 [TaxId: 206162]} mqtvnemlrraatrapdhcalavparglrlthaelrarveavaarlhadglrpqqrvavv apnsadvviailalhrlgavpallnprlksaelaelikrgemtaaviavgrqvadaifqs gsgariiflgdlvrdgepysygppiedpqrepaqpafifytsgttglpkaaiipqraaes rvlfmstqvglrhgrhnvvlglmplyhvvgffavlvaalaldgtyvvveefrpvdalqlv qqeqvtslfatpthldalaaaaahagsslkldslrhvtfagatmpdavletvhqhlpgek vniygtteamnslymrqpktgtemapgffsevrivrigggvdeivangeegelivaasds afvgylnqpqataeklqdgwyrtsdvavwtpegtvrilgrvddmiisggenihpseierv lgtapgvtevvvigladqrwgqsvtacvvprlgetlsadaldtfcrsseladfkrpkryf ildqlpknalnkvlrrqlvqqvs
Timeline for d3cw9b_: