Lineage for d3cw9a_ (3cw9 A:)

  1. Root: SCOPe 2.01
  2. 1054197Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1057121Fold e.23: Acetyl-CoA synthetase-like [56800] (1 superfamily)
    4 domains: (1&2) duplication: share the same alpha/beta fold; (3) beta-barrel; (4) alpha+beta
  4. 1057122Superfamily e.23.1: Acetyl-CoA synthetase-like [56801] (2 families) (S)
  5. 1057123Family e.23.1.1: Acetyl-CoA synthetase-like [56802] (6 proteins)
  6. 1057124Protein 4-chlorobenzoyl CoA ligase [111316] (1 species)
  7. 1057125Species Alcaligenes sp. AL3007 [TaxId:206162] [111317] (9 PDB entries)
    Uniprot Q8GN86
  8. 1057126Domain d3cw9a_: 3cw9 A: [157035]
    automated match to d1t5dx_
    complexed with 01a, amp, edo, mg, no3

Details for d3cw9a_

PDB Entry: 3cw9 (more details), 2 Å

PDB Description: 4-Chlorobenzoyl-CoA Ligase/Synthetase in the Thioester-forming Conformation, bound to 4-chlorophenacyl-CoA
PDB Compounds: (A:) 4-chlorobenzoyl CoA ligase

SCOPe Domain Sequences for d3cw9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cw9a_ e.23.1.1 (A:) 4-chlorobenzoyl CoA ligase {Alcaligenes sp. AL3007 [TaxId: 206162]}
mqtvnemlrraatrapdhcalavparglrlthaelrarveavaarlhadglrpqqrvavv
apnsadvviailalhrlgavpallnprlksaelaelikrgemtaaviavgrqvadaifqs
gsgariiflgdlvrdgepysygppiedpqrepaqpafifytsgttglpkaaiipqraaes
rvlfmstqvglrhgrhnvvlglmplyhvvgffavlvaalaldgtyvvveefrpvdalqlv
qqeqvtslfatpthldalaaaaahagsslkldslrhvtfagatmpdavletvhqhlpgek
vniygtteamnslymrqpktgtemapgffsevrivrigggvdeivangeegelivaasds
afvgylnqpqataeklqdgwyrtsdvavwtpegtvrilgrvddmiisggenihpseierv
lgtapgvtevvvigladqrwgqsvtacvvprlgetlsadaldtfcrsseladfkrpkryf
ildqlpknalnkvlrrqlvqqvs

SCOPe Domain Coordinates for d3cw9a_:

Click to download the PDB-style file with coordinates for d3cw9a_.
(The format of our PDB-style files is described here.)

Timeline for d3cw9a_: