Lineage for d3cvhm2 (3cvh M:1-181)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2182595Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2182596Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2182597Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2182691Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2183117Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (47 PDB entries)
    Uniprot P01901 22-299
  8. 2183168Domain d3cvhm2: 3cvh M:1-181 [157007]
    Other proteins in same PDB: d3cvha1, d3cvhb_, d3cvhh1, d3cvhl1, d3cvhl2, d3cvhm1, d3cvhn_, d3cvhq1, d3cvhr1, d3cvhr2
    automated match to d1lk2a2

Details for d3cvhm2

PDB Entry: 3cvh (more details), 2.9 Å

PDB Description: how tcr-like antibody recognizes mhc-bound peptide
PDB Compounds: (M:) h-2 class I histocompatibility antigen, k-b alpha chain

SCOPe Domain Sequences for d3cvhm2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cvhm2 d.19.1.1 (M:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB [TaxId: 10090]}
gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
r

SCOPe Domain Coordinates for d3cvhm2:

Click to download the PDB-style file with coordinates for d3cvhm2.
(The format of our PDB-style files is described here.)

Timeline for d3cvhm2: