Lineage for d1fafa_ (1faf A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 811Fold a.2: Long alpha-hairpin [46556] (11 superfamilies)
  4. 822Superfamily a.2.3: Chaperone J-domain [46565] (1 family) (S)
  5. 823Family a.2.3.1: Chaperone J-domain [46566] (4 proteins)
  6. 837Protein Large T antigen, the N-terminal J domain [46573] (1 species)
  7. 838Species Murine polyomavirus [TaxId:10634] [46574] (1 PDB entry)
  8. 839Domain d1fafa_: 1faf A: [15700]

Details for d1fafa_

PDB Entry: 1faf (more details)

PDB Description: nmr structure of the n-terminal j domain of murine polyomavirus t antigens.

SCOP Domain Sequences for d1fafa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus}
mdrvlsradkerllellklprqlwgdfgrmqqaykqqslllhpdkggshalmqelnslwg
tfktevynlrmnlggtgfq

SCOP Domain Coordinates for d1fafa_:

Click to download the PDB-style file with coordinates for d1fafa_.
(The format of our PDB-style files is described here.)

Timeline for d1fafa_: