Lineage for d1fafa_ (1faf A:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.2: Long alpha-hairpin [46556] (11 superfamilies) 
Superfamily a.2.3: Chaperone J-domain [46565] (1 family) 
Family a.2.3.1: Chaperone J-domain [46566] (4 proteins) 
Protein Large T antigen, the N-terminal J domain [46573] (1 species) Species Murine polyomavirus [TaxId:10634] [46574] (1 PDB entry) 
Domain d1fafa_: 1faf A: [15700]
Details for d1fafa_
PDB Entry: 1faf (more details)
PDB Description: nmr structure of the n-terminal j domain of murine polyomavirus t antigens.
SCOP Domain Sequences for d1fafa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus}
mdrvlsradkerllellklprqlwgdfgrmqqaykqqslllhpdkggshalmqelnslwg
tfktevynlrmnlggtgfq
SCOP Domain Coordinates for d1fafa_:
Click to download the PDB-style file with coordinates for d1fafa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fafa_:
- d1fafa_ appears in SCOP 1.57
- d1fafa_ appears in the current release, SCOPe 2.08
