SCOP 1.75: Domain d3cuna1: 3cun A:302-392

Lineage for d3cuna1 (3cun A:302-392)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (5 families)

5. Family d.58.7.1: Canonical RBD [54929] (67 proteins)

6. Protein Splicesomal U1A protein [54932] (2 species)
   duplication: contains two domains of this fold

7. Species Human (Homo sapiens) [TaxId:9606] [54933] (33 PDB entries)
   Uniprot P09012 1-97
   Uniprot P09012 4-98
   Uniprot P09012 1-98
   Uniprot P09012 1-97 ! Uniprot P09012 4-98 ! Uniprot P09012 1-98

8. Domain d3cuna1: 3cun A:302-392 [156997]
   automatically matched to d1auda_
   complexed with co, gtp, k, mg; mutant

Details for d3cuna1

PDB Entry: 3cun, 3 Å

PDB Description: aminoacyl-trna synthetase ribozyme

PDB Compounds: (A:) U1 small nuclear ribonucleoprotein A

SCOP Domain Sequences for d3cuna1:

Sequence; same for both SEQRES and ATOM records:

>d3cuna1 d.58.7.1 (A:302-392) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]}
rpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevssat
nalrsmqgfpfydkpmriqyaktdsdiiakm

Timeline for d3cuna1:

• d3cuna1 is new in SCOP 1.75
  
• d3cuna1 appears in SCOPe 2.01
  
• d3cuna1 appears in the current release, SCOPe 2.08, called d3cuna_